CJC-1295 raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2026-06-27 and is reviewed periodically as new material appears.
CJC-1295 is a synthetic peptide belonging to the growth hormone-releasing hormone analog family. It comprises twenty-nine amino acid residues derived from the N-terminal region of natural GHRH. The molecule incorporates several non-natural substitutions that increase resistance to enzymatic degradation. These modifications extend its activity compared with the native hormone fragment. Researchers use it to study pituitary growth hormone secretion in laboratory and clinical settings. This compound is distinct from native GHRH in its stability profile.
Two principal forms appear in the literature and in research supply. One carries a drug affinity complex, a maleimide-based group that forms a covalent bond with circulating albumin. This linkage slows clearance and produces a long-lasting elevation of peptide levels. The other form lacks that group and is often labeled MOD GRF(1-29). It has a much shorter circulation time. Both variants retain the same core receptor-binding sequence. Reported half-lives differ substantially between the two.
Binding of the peptide to the growth hormone-releasing hormone receptor on pituitary somatotrophs triggers a G protein coupled cascade that raises cyclic AMP and opens calcium channels. The result is greater secretion of growth hormone into the bloodstream. Because the peptide acts at the same receptor as the natural hypothalamic hormone, its effect is amplified pulse size rather than an entirely separate release pathway. Receptor binding alone does not determine the response, since somatostatin tone and other inputs modulate the final output.
The albumin-binding version stays in circulation for days, because covalent attachment to serum albumin shields the peptide from rapid filtration and degradation. Reported half-lives for this form fall in the range of several days. The version without the linker is cleared in minutes, with estimates often near thirty minutes in animal work. These figures come from small studies and vary with assay method, species, and route, so they are best read as approximate rather than fixed constants.
| Property | Value | Notes |
|---|---|---|
| Molecular weight, DAC form | About 3647 Da | Varies with salt form |
| Molecular weight, non-DAC form | About 3358 Da | MOD GRF(1-29) |
| Solubility class | Water soluble | Also dissolves in polar solvents |
| Reported half-life, DAC form | About five to eight days | Values from human studies |
| Common synonyms | CJC-1295; MOD GRF(1-29) | Name depends on variant |
A typical intracellular concentration of ATP is 1–10 μmol per gram of muscle tissue in a variety of eukaryotes. The dephosphorylation of ATP and rephosphorylation of ADP and AMP occur repeatedly in the course of aerobic metabolism. ATP can be produced by a number of distinct cellular processes; the three main pathways in eukaryotes are (1) glycolysis, (2) the citric acid cycle/oxidative phosphorylation, and (3) beta-oxidation. The overall process of oxidizing glucose to carbon dioxide, the combination of pathways 1 and 2, known as cellular respiration, produces about 30 equivalents of ATP from each molecule of glucose. ATP production by a non-photosynthetic aerobic eukaryote occurs mainly in the mitochondria, which comprise nearly 25% of the volume of a typical cell.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
A lot of effort has been put into controlling cell selectivity. For example, attempts have been made to modify and optimize the physicochemical parameters of the peptides to control the selectivities, including net charge, helicity, hydrophobicity per residue (H), hydrophobic moment (μ) and the angle subtended by the positively charged polar helix face (Φ). Other mechanisms like the introduction of D-amino acids and fluorinated amino acids in the hydrophobic phase are believed to break the secondary structure and thus reduce hydrophobic interaction with mammalian cells. It has also been found that Pro→Nlys substitution in Pro-containing β-turn antimicrobial peptides was a promising strategy for the design of new small bacterial cell-selective antimicrobial peptides with intracellular mechanisms of action. It has been suggested that direct attachment of magainin to the substrate surface decreased nonspecific cell binding and led to improved detection limit for bacterial cells such as Salmonella and E. coli.
Sources: en.wikipedia.org
Caspases play the central role in the transduction of ER apoptotic signals. Caspases are proteins that are highly conserved, cysteine-dependent aspartate-specific proteases. There are two types of caspases: initiator caspases (caspases 2, 8, 9, 10, 11, and 12) and effector caspases (caspases 3, 6, and 7). The activation of initiator caspases requires binding to specific oligomeric activator protein. These active initiator caspases activate the effector caspases through proteolytic cleavage. The active effector caspases then proteolytically degrade a host of intracellular proteins to carry out the cell death program. There also exists a caspase-independent apoptotic pathway that is mediated by AIF (apoptosis-inducing factor).
S-Arrestin is a protein found in mice that binds to rhodopsin to stop its activity, preventing further signaling. S-arrestin binds to G protein-coupled receptors (GPCRs), like rhodopsin, following receptor activation and phosphorylation by G protein-coupled receptor kinases (GRKs). Rhodopsin is found in rod cells of the retina, essential for vision. It detects light and initiates a signaling cascade called phototransduction. However, excessive activation can be harmful, so it must be carefully regulated. The phosphorylation of the receptor's intracellular loops and C-terminal tail creates a high-affinity binding site for S-arrestin. S-arrestin then sterically hinders further G protein coupling, effectively desensitizing the receptor and directing it towards alternative signaling pathways or internalization via clathrin-mediated endocytosis.
In terms of dosage equivalence, norethisterone and NETA are typically used at respective dosages of 0.35 mg/day and 0.6 mg/day as progestogen-only contraceptives, and at respective dosages of 0.5–1 mg/day and 1–1.5 mg/day in combination with ethinylestradiol in combined oral contraceptives. Conversely, the two drugs have been used at about the same dosages in menopausal hormone therapy for the treatment of menopausal symptoms. NETA is of about 12% higher molecular weight than norethisterone due to the presence of its C17β acetate ester. Micronization of NETA has been found to increase its potency by several-fold in animals and women. The endometrial transformation dosage of micronized NETA per cycle is 12 to 14 mg, whereas that for non-micronized NETA is 30 to 60 mg.
Sources: en.wikipedia.org
The domain of automotive design has been traditionally characterized as male-dominated. As a result, there has been a lack of female automotive designers in the area of automotive safety compared to male automotive designers. This leads to oversights in automotive safety and ergonomics for female consumers, who make up 62% of all new cars sold in the USA. According to the Insurance Institute for Highway Safety (IIHS), women are less likely to get into a crash than men are. However, women are 17% more likely to die in a car crash and 73% more likely to sustain serious injuries from a crash when compared to men. In rear-end collisions, female drivers face a higher risk of whiplash injuries when compared to their male counterparts due to their lighter weight which causes them to be propelled forward more rapidly. To mitigate these problems, Consumer Reports states that regulators have called for a female crash dummy to be implemented in crash testing since 1980. When pregnant, women should continue to use seatbelts and airbags properly. A University of Michigan study found that "unrestrained or improperly restrained pregnant women are 5.7 times more likely to have an adverse fetal outcome than properly restrained pregnant women". If seatbelts are not long enough, extensions are available from the car manufacturer or an aftermarket supplier.
The first automated insulin delivery system was known as the Biostator. Currently available AID systems fall into three broad classes based on their capabilities. The first systems released can only halt insulin delivery (predictive low glucose suspend) in response to already low or predicted low glucose. Hybrid Closed Loop systems can modulate delivery both up and down, although users still initiate insulin doses (boluses) for meals and typically "announce" or enter meal information. Fully Closed Loops require no manual insulin delivery actions or announcement for meals. A step forward from threshold suspend systems, predictive low glucose suspend (PLGS) systems use a mathematical model to extrapolate predicted future blood sugar levels based on recent past readings from a CGM. This allows the system to reduce or halt insulin delivery prior to a predicted hypoglycemic event.
The HIE-ISOLDE project introduced a network of High Energy Beam Transfer (HEBT) beamlines to the ISOLDE facility. The common section beamline, XT00, joins to three bending beamlines (XT01, XT02, XT03) leading to different experiment setups. The three identical beamlines are independent of each other, for example, if the first XT01 dipole magnet is off, the beam will continue to the XT02 and XT03. They all bend the beam by 90 degrees and focus it using two dipole magnets and a doublet-quadrupole. The XT01 beamline leads to Miniball, the XT02 beamline leads to the ISS, and the XT03 beamline leads to movable setups, such as the SEC scattering chamber. Offline 2 was recently installed as a mass separator beamline at ISOLDE, with the purpose of satisfying the increased demands on the original offline facility, Offline 1. The facility includes the beamline enclosed in a Faraday cage as well as a laser laboratory and control station. The offline facility is designed for target test studies, and upgraded to include potential for the production and study of molecular ion beams.
Two species of AAV were recognised by the International Committee on Taxonomy of Viruses in 2013: adeno-associated dependoparvovirus A (formerly AAV-1, −2, −3 and −4) and adeno-associated dependoparvovirus B (formerly AAV-5). Until the 1990s, virtually all AAV biology was studied using AAV serotype 2. However, AAV is highly prevalent in humans and other primates and several serotypes have been isolated from various tissue samples. Serotypes 2, 3, 5, and 6 were discovered in human cells, AAV serotypes 1, 4, and 7–11 in nonhuman primate samples. As of 2006 there have been 11 AAV serotypes described, the 11th in 2004. AAV capsid proteins contain 12 hypervariable surface regions, with most variability occurring in the threefold proximal peaks, but the parvovirus genome in general presents highly conserved replication and structural genes across serotypes. All of the known serotypes can infect cells from multiple diverse tissue types.
Sources: en.wikipedia.org
It is a synthetic peptide modeled on growth hormone-releasing hormone. The molecule is used in research on pituitary growth hormone secretion. It differs from the natural hormone through several stabilizing substitutions.
The DAC form carries a maleimide group that binds albumin and extends circulation time. The non-DAC form lacks this group and clears much faster. Both share the same receptor-binding core.
It targets the growth hormone-releasing hormone receptor on pituitary somatotroph cells. Activation raises cyclic AMP and promotes growth hormone release. Normal feedback pathways remain part of the response.
Reported values cluster in the range of several days, reflecting slow release from the albumin complex. Estimates differ across species and assay platforms. The figure describes circulation time in study settings rather than a fixed property.